PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G14440.2
Common NameAtHB31, F14L17.21, FTM2, HB31, ZHD4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ZF-HD
Protein Properties Length: 312aa    MW: 35481.8 Da    PI: 7.6257
Description homeobox protein 31
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G14440.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.43e-3287142359
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                   ++YkeClkNhAa++Gg+a+DGCgEfmps ge+g+++al+C+AC+CHRnFHR+eve 
  AT1G14440.2  87 MIKYKECLKNHAAAMGGNATDGCGEFMPS-GEDGSIEALTCSACNCHRNFHRKEVEG 142
                  689*************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.3E-2888140IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257745.0E-3288151IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.8E-3189140IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.43690139IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.07E-19207279IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-29212280IPR009057Homeodomain-like
TIGRFAMsTIGR015657.0E-27218274IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020137anatomyleaf apex
PO:0020148anatomyshoot apical meristem
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MEIASQEDHD MPIPLNTTFG GGGSHGHMIH HHDHHAANSA PPTHNNNNTT QPPPMPLHGN  60
GHGNNYDHHH HQDPHHVGYN AIIKKPMIKY KECLKNHAAA MGGNATDGCG EFMPSGEDGS  120
IEALTCSACN CHRNFHRKEV EGELAATAMS PYHQHPPHRK LMLNHQKIRS AMPHQMIMPI  180
GVSNYRYMHN NSESEDFMEE DGVTTASRSL PNLPYNQKKR FRTKFTPEQK EKMLSFAEKV  240
GWKIQRQEDC VVQRFCEEIG VKRRVLKVWM HNNKIHFSKK NNINLEDNDN EKINNLNNVD  300
LSGNNDMTKI VP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A8e-242192741873ZF-HD homeobox family protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.419720.0flower| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1864784810.0
Genevisible261502_at1e-154
Expression AtlasAT1G14440-
AtGenExpressAT1G14440-
ATTED-IIAT1G14440-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Not detected in the meristem prior to exposure to long days (LDs), but after exposure to three LDs, stable accumulation on the flanks of the meristem adjacent to floral primordia, during floral induction. {ECO:0000269|PubMed:22319055}.
UniprotTISSUE SPECIFICITY: Mostly expressed in flowers and inflorescence. {ECO:0000269|PubMed:16428600}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Probably involved in the regulation of floral induction. {ECO:0000269|PubMed:22319055}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G14440.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by exposure to long days. {ECO:0000269|PubMed:22319055}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G69600, AT1G75240
IntActSearch Q9M9S0
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G14440
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0742660.0AY074266.1 Arabidopsis thaliana unknown protein (At1g14440) mRNA, complete cds.
GenBankAY0967380.0AY096738.1 Arabidopsis thaliana unknown protein (At1g14440) mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankF14L170.0AC012188.2 Sequence of BAC F14L17 from Arabidopsis thaliana chromosome 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172896.10.0homeobox protein 31
RefseqNP_973826.10.0homeobox protein 31
SwissprotQ9M9S00.0ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLD7KBK30.0D7KBK3_ARALL; ATHB31
STRINGAT1G14440.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  2. Tan QK,Irish VF
    The Arabidopsis zinc finger-homeodomain genes encode proteins with unique biochemical properties that are coordinately expressed during floral development.
    Plant Physiol., 2006. 140(3): p. 1095-108
    [PMID:16428600]
  3. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  4. Bassel GW, et al.
    Elucidating the germination transcriptional program using small molecules.
    Plant Physiol., 2008. 147(1): p. 143-55
    [PMID:18359847]
  5. Hu W,dePamphilis CW,Ma H
    Phylogenetic analysis of the plant-specific zinc finger-homeobox and mini zinc finger gene families.
    J Integr Plant Biol, 2008. 50(8): p. 1031-45
    [PMID:18713354]
  6. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  7. Hong SY,Kim OK,Kim SG,Yang MS,Park CM
    Nuclear import and DNA binding of the ZHD5 transcription factor is modulated by a competitive peptide inhibitor in Arabidopsis.
    J. Biol. Chem., 2011. 286(2): p. 1659-68
    [PMID:21059647]
  8. Torti S, et al.
    Analysis of the Arabidopsis shoot meristem transcriptome during floral transition identifies distinct regulatory patterns and a leucine-rich repeat protein that promotes flowering.
    Plant Cell, 2012. 24(2): p. 444-62
    [PMID:22319055]